PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589244.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 278aa    MW: 31771.4 Da    PI: 8.2342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589244.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.6e-092873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE + + da +++ ++    W  +a++++ g+t ++++  ++ 
   XP_009589244.1 28 KWTAEENKMFEDALALFDKDtpdKWYNVAAMIP-GKTVNDVIKQYRE 73
                     8********************************.********99986 PP

2Myb_DNA-binding46.39.7e-15133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
   XP_009589244.1 133 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 177
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-42374IPR009057Homeodomain-like
PROSITE profilePS512937.832479IPR017884SANT domain
SMARTSM007171.2E-92577IPR001005SANT/Myb domain
CDDcd001674.08E-72875No hitNo description
SuperFamilySSF466891.58E-112881IPR009057Homeodomain-like
PfamPF002493.3E-72874IPR001005SANT/Myb domain
PROSITE profilePS5129421.106126182IPR017930Myb domain
SuperFamilySSF466891.87E-17128181IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-18129181IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-12130177IPR009057Homeodomain-like
SMARTSM007173.5E-13130180IPR001005SANT/Myb domain
CDDcd001671.02E-10133178No hitNo description
PfamPF002493.5E-12133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MKREMGFLSP ATYIKNSSWL FEENKVTKWT AEENKMFEDA LALFDKDTPD KWYNVAAMIP  60
GKTVNDVIKQ YRELVEDISD IEAGLIPVPG YTTSNSFTLE WVNNQDGFKQ FYGQTGKRGA  120
NRSSEHERKK GVPWTEEEHR QFLLGLKKYG KGDWRNISRN FVTTRTPTQV ASHAQKYFIR  180
QLSGGKDKRR SSIHDITVVN LSESKSTSPE NHSQQQHHSM VKTLCDNNSP NQEDITFNSS  240
SGDLITTPFR GVSSYGLEHG MHSITLQSLQ FGHYNTMC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1929941176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755211e-126HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589244.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H71e-100DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0V0I9A00.0A0A0V0I9A0_SOLCH; Putative transcription factor DIVARICATA-like
STRINGSolyc09g014250.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-110MYB family protein